An official website of the United States government.

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

National Agricultural Library
U.S. Department of Agriculture
  1. Home
  2. Human Nutrition and Food Safety
  3. Research Publications (Food Safety)

Research Publications (Food Safety)

This page tracks research articles published in national and international peer-reviewed journals. Recent articles are available ahead of print and searchable by Journal, Article Title, and Category. Research publications are tracked across six categories: Bacterial Pathogens, Chemical Contaminants, Natural Toxins, Parasites, Produce Safety, and Viruses. Articles produced by USDA Grant Funding Agencies (requires login) and FDA Grant Funding Agencies (requires login) are also tracked in Scopus.

Displaying 7576 - 7600 of 41911

  1. Advances in Chicken IgY-Based Immunoassays for the Detection of Chemical and Biological Hazards in Food Samples

    • Journal of Agricultural and Food Chemistry

    • As antibodies are the main biological binder for hazards in food samples, their performance directly determines the sensitivity, specificity, and reproducibility of the developed immunoassay. The overwhelmingly used mammalian-derived antibodies usually suffer from complicated preparation, high cost, frequent bleeding of animals, and sometimes low titer and affinity.

      • Chemical contaminants
      • Pesticide residues

  2. A Novel Class IIb Bacteriocin-Plantaricin EmF Effectively Inhibits Listeria monocytogenes and Extends the Shelf Life of Beef in Combination with Chitosan

    • Journal of Agricultural and Food Chemistry

    • Plantaricin EmF separated and identified from L. plantarum 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Its mode of action on L.

      • Bacterial pathogens
      • Listeria monocytogenes

  3. Prioritizing COVID-19 Contact Tracing During a Surge Using Chatbot Technology

    • American Journal of Public Health
      • Viruses
      • COVID-19

  4. Accuracy of Case-Based Seroprevalence of SARS-CoV-2 Antibodies in Maricopa County, Arizona

    • American Journal of Public Health
      • Viruses
      • COVID-19

  5. Deployment of Health Equity Strike Teams to Address COVID-19 Vaccine Disparities in Arkansas, 2021

    • American Journal of Public Health
      • Viruses
      • COVID-19

  6. Ballroom Icons and the Power to Promote COVID-19 Vaccination Among Black and Brown LGBTQ+ Individuals

    • American Journal of Public Health
      • Viruses
      • COVID-19

  7. Ten Public Health Tips to Heal From COVID-19 Losses

    • American Journal of Public Health
      • Viruses
      • COVID-19

  8. Diarrhoea‐causing enteric protist species in intensively and extensively raised pigs (Sus scrofa domesticus) in Southern Spain. Part II: Association with Hepatitis E virus susceptibility

    • Transboundary and Emerging Diseases

    • Transboundary and Emerging Diseases, EarlyView.

      • Viruses
      • Hepatitis

  9. Screening for hepatitis E virus genotype 3 in red deer (Cervus elaphus) and fallow deer (Dama dama), Portugal, 2018–2020

    • Transboundary and Emerging Diseases

    • Transboundary and Emerging Diseases, EarlyView.

      • Viruses
      • Hepatitis

  10. Isolation and characterization of a novel strain of duck aviadenovirus B from Muscovy ducklings with acute hepatitis in China

    • Transboundary and Emerging Diseases

    • Transboundary and Emerging Diseases, EarlyView.

      • Viruses
      • Hepatitis

  11. First report of equine parvovirus‐hepatitis and equine hepacivirus coinfection in horses in Korea

    • Transboundary and Emerging Diseases

    • Transboundary and Emerging Diseases, EarlyView.

      • Viruses
      • Hepatitis

  12. Serological and molecular survey of hepatitis E virus in cats and dogs in Spain

    • Transboundary and Emerging Diseases

    • Transboundary and Emerging Diseases, EarlyView.

      • Viruses
      • Hepatitis

  13. Zoonotic transmission of hepatitis E virus in a pig farmer from Argentina: A case report

    • Zoonoses and Public Health

    • Zoonoses and Public Health, EarlyView.

      • Viruses
      • Hepatitis

  14. Local‐scale diversity of Yersinia pestis: A case study from Ambohitromby, Ankazobe District, Madagascar

    • Zoonoses and Public Health

    • Zoonoses and Public Health, Volume 69, Issue 1, Page 61-70, February 2022.

      • Bacterial pathogens
      • Yersinia

  15. Examination of Australian backyard poultry for Salmonella, Campylobacter and Shigella spp., and related risk factors

    • Zoonoses and Public Health

    • Zoonoses and Public Health, Volume 69, Issue 1, Page 13-22, February 2022. Worldwide, foodborne illness is a significant public health issue in both developed and developing countries. Salmonellosis, campylobacteriosis and shigellosis are common foodborne gastrointestinal illnesses caused by the bacteria Salmonella spp., Campylobacter spp. and Shigella spp. respectively.

      • Bacterial pathogens
      • Campylobacter
      • Salmonella
      • Shigella

  16. Genomic diversity and resistome profiles of Salmonella enterica subsp. enterica serovar Kentucky isolated from food and animal sources in Ireland

    • Zoonoses and Public Health

    • Zoonoses and Public Health, Volume 69, Issue 1, Page 1-12, February 2022. Salmonella enterica subsp. enterica serovar Kentucky is frequently isolated from poultry, dairy and beef cattle, the environment and people with clinical salmonellosis globally. However, the sources of this serovar and its diversity and antimicrobial resistance capacities remain poorly described in many regions.

      • Bacterial pathogens
      • Salmonella

  17. Modelling the introduction and transmission of Campylobacter in a North American chicken flock

    • Zoonoses and Public Health

    • Zoonoses and Public Health, Volume 69, Issue 1, Page 23-32, February 2022.

      • Bacterial pathogens
      • Campylobacter

  18. Giardia duodenalis in colony stray cats from Italy

    • Zoonoses and Public Health

    • Zoonoses and Public Health, Volume 69, Issue 1, Page 46-54, February 2022.

      • Parasites
      • Giardia lamblia

  19. Genomic diversities of ctxB, tcpA and rstR alleles of Vibrio cholerae O139 strains isolated from Odisha, India

    • Environmental Microbiology Reports

    • Environmental Microbiology Reports, EarlyView.

      • Bacterial pathogens
      • Vibrio

  20. Whole‐genome sequence analysis of Staphylococcus aureus from retail fish acknowledged the incidence of highly virulent ST672‐MRSA‐IVa/t1309, an emerging Indian clone, in Assam, India

    • Environmental Microbiology Reports

    • Environmental Microbiology Reports, EarlyView.

      • Bacterial pathogens
      • Staphylococcus aureus

  21. Efficiency and specificity of CARD‐FISH probes in detection of marine vibrios

    • Environmental Microbiology Reports

    • Environmental Microbiology Reports, Volume 13, Issue 6, Page 928-933, December 2021.

      • Bacterial pathogens
      • Vibrio

  22. Critical timing of fungicide application for pruning wound protection to control grapevine trunk diseases

    • Australian Journal of Grape and Wine Research

    • Australian Journal of Grape and Wine Research, Volume 28, Issue 1, Page 70-74, January 2022.

      • Chemical contaminants
      • Pesticide residues

  23. Efficiency of calcined Aluminum‐Magnesium layered double hydroxide for adsorption of aflatoxin M1 from solution and matrix of milk

    • Journal of Food Science

    • Journal of Food Science, Volume 86, Issue 12, Page 5200-5212, December 2021.

      • Natural toxins
      • Aflatoxins
      • Mycotoxins

  24. A single‐walled carbon nanotubes‐based electrochemical impedance immunosensor for on‐site detection of Listeria monocytogenes

    • Journal of Food Science

    • Journal of Food Science, EarlyView.

      • Bacterial pathogens
      • Listeria monocytogenes

  25. Analysis of dietary exposure and risk assessment of pesticide residues in roots and rhizomes of Chinese herbs

    • Journal of Food Science

    • Journal of Food Science, EarlyView.

      • Chemical contaminants
      • Pesticide residues