An official website of the United States government.

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

Research Publications (Food Safety)

This page tracks research articles published in national and international peer-reviewed journals. Recent articles are available ahead of print and searchable by Journal, Article Title, and Category. Research publications are tracked across six categories: Bacterial Pathogens, Chemical Contaminants, Natural Toxins, Parasites, Produce Safety, and Viruses. Articles produced by USDA Grant Funding Agencies (requires login) and FDA Grant Funding Agencies (requires login) are also tracked in Scopus.

Displaying 8026 - 8050 of 42106

  1. Prevalence, risk factor and diversity of Cryptosporidium in cattle in Latvia

    • Veterinary Parasitology: Regional Studies and Reports
    • The epidemiology of Cryptosporidium spp. in Latvia was investigated by testing fecal samples from 926 animals aged from one day to 24 years for the presence of Cryptosporidium spp. oocysts.

      • Parasites
      • Cryptosporidium parvum
  2. Functional characterization of a GH62 family α-L-arabinofuranosidase from Eupenicillium parvum suitable for monosaccharification of corncob arabinoxylan in combination with key enzymes

    • Enzyme and Microbial Technology
      • Parasites
      • Cryptosporidium parvum
  3. A guide to standardise artificial contamination procedures with protozoan parasite oocysts or cysts during method evaluation, using Cryptosporidium and leafy greens as models

    • Food Control
      • Parasites
      • Cryptosporidium parvum
  4. Interactions between Cryptosporidium parvum and bovine corona virus during sequential and simultaneous infection of HCT-8 cells

    • Microbes and Infection
      • Parasites
      • Cryptosporidium parvum
      • Viruses
      • COVID-19
  5. A global systematic review and meta-analysis on prevalence of the aflatoxin B1 contamination in olive oil

    • Journal of Food Science and Technology
    • Olive oil can be contaminated by fungal toxins; therefore, it is necessary to monitor the incidence of mycotoxins in this oil. In the present study, the pooled prevalence of detectable aflatoxin B1 (AFB1) in olive oil was evaluated using systematic review and meta-analysis approach from 1 January 1991 to 31 December 2020 (30 years study). The search was conducted via electronic databases involving Scopus, Web of Science, PubMed, Agris and Agricola.

      • Aflatoxins
      • Natural toxins
  6. A Natural Deep Eutectic Solvent–based Ultrasound-Vortex-assisted Dispersive Liquid–Liquid Microextraction Method for Ligand-less Pre-concentration and Determination of Traces of Cadmium Ions in Water and Some Food Samples

    • Food Analytical Methods
    • Abstract  

      • Heavy Metals
      • Chemical contaminants
  7. Removal of antibiotic thiamphenicol by bacterium Aeromonas hydrophila HS01

    • World Journal of Microbiology and Biotechnology
    • Abstract

      • Antibiotic residues
      • Bacterial pathogens
      • Chemical contaminants
  8. Indolicidin revisited: biological activity, potential applications and perspectives of an antimicrobial peptide not yet fully explored

    • World Journal of Microbiology and Biotechnology
    • The emergence of multidrug-resistant bacteria, viruses and tumors is a serious threat to public health. Among natural peptides, indolicidin, a 13-residue peptide belonging to the cathelicidin family, deserves special attention. Indolicidin has a broad spectrum of biological activity and is active against a wide range of targets, such as bacteria (Gram+  and Gram−), fungi and viruses.

      • Antibiotic residues
      • Chemical contaminants
  9. Elution of Sulfuric Compounds from Na-sulfide Waste for Stable Management at a Disposal Site: an Experimental Investigation

    • Water, Air, & Soil Pollution
    • We investigated the dissolution and oxidation behaviors of sulfuric waste from secondary batteries by reacting the waste with synthetic rainwater to examine the optimal management of this waste at a disposal site. Morphological observation and chemical analysis of bulk sulfur (S) wastes revealed heterogeneous distributions of sodium sulfide (NaS) and thiosulfate (Na2S2O3).

  10. Quaternized chitosan as a biopolymer sanitizer for leafy vegetables: synthesis, characteristics, and traditional vs. dry nano-aerosol applications

    • Food Chemistry
    • Author(s): Yael Cohen, Esther Mwangi, Nimrod Tish, Jie Xu, Nachiket D. Vaze, Tal Klingbell, Elazar Fallik, Yaguang Luo, Philip Demokritou, Victor Rodov, Elena Poverenov

  11. Effect of humic and calcareous substance amendments on the availability of cadmium in paddy soil and its accumulation in rice

    • Ecotoxicology and Environmental Safety
    • Author(s): Hao Liu, Tuo Zhang, Yan’an Tong, Qihong Zhu, Daoyou Huang, Xibai Zeng

      • Heavy Metals
      • Chemical contaminants
  12. Genomic evolution of the globally disseminated multidrug-resistant Klebsiella pneumoniae clonal group 147

    • Microbiology
    • The rapid emergence of multidrug-resistant is being driven largely by the spread of specific clonal groups (CGs). Of these, CG147 includes 7-gene multilocus sequence typing (MLST) sequence types (STs) ST147, ST273 and ST392.

      • Bacterial pathogens
  13. Evaluation of the virucidal efficacy of Klaran UVC LEDs against surface-dried norovirus

    • Microbiology
    • Human norovirus (HuNoV) is a highly contagious pathogenic virus that is transmitted through contaminated food, water, high-touch surfaces and aerosols. Globally, there are an estimated 685 million infections annually due to norovirus, including 200 million affecting children under the age of 5. HuNoV causes approximately 50, 000 child deaths per year and costs an estimated USD $60 billion annually in healthcare.

      • Norovirus
      • Viruses
  14. Antibiotic resistance, virulence, and phylogenetic analysis of Escherichia coli strains isolated from free-living birds in human habitats

    • PLOS ONE
    • by Bartosz Rybak, Beata Krawczyk, Beata Furmanek-Blaszk, Magdalena Wysocka, Magdalena Fordon, Pawel Ziolkowski, Wlodzimierz Meissner, Katarzyna Stepniewska, Katarzyna Sikorska

      • Bacterial pathogens
  15. Aerobic polychlorinated biphenyl-degrading bacteria isolated from the Tohoku region of Japan are not regionally endemic

    • Canadian Journal of Microbiology
    • In the Tohoku region of Japan, 72% of the land comprises mountain forest zones. During winter, severe climatic conditions include heavy snowfall. In such an environment, which is considered high in biodiversity, we assumed that aerobic bacteria would be diverse and would possess the ability to degrade polychlorinated biphenyls (PCBs). In this study, 78 environmental samples were collected from the Tohoku region and 56 aerobic PCB-degrading bacterial strains were isolated.

      • Chemical contaminants
  16. A Novel Class IIb Bacteriocin-Plantaricin EmF Effectively Inhibits Listeria monocytogenes and Extends the Shelf Life of Beef in Combination with Chitosan

    • Journal of Agricultural and Food Chemistry
    • Plantaricin EmF separated and identified from L. plantarum 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Its mode of action on L.

      • Listeria monocytogenes
      • Bacterial pathogens
  17. Nanobody-Based Bispecific Neutralizer for Shiga Toxin-Producing E.coli

    • ACS Infectious Diseases
    • Currently, no specific therapeutics are available for foodborne Shiga toxin-producing Escherichia coli (STEC) infections that cause severe gastroenteritis and life-threatening complications of hemolytic uremic syndrome (HUS). As STEC attachment to intestinal epithelium might increase the host absorption of Shiga toxins and severity of the disease, we were inspired to develop a bispecific neutralizer capable of blocking its Shiga toxin and adhesin intimin simultaneously.

      • Bacterial pathogens
  18. Whole Genome Sequencing Reveals Biopesticidal Origin of Bacillus thuringiensis in Foods

    • Frontiers in Microbiology
    • Bacillus thuringiensis is a microbial insecticide widely used to control agricultural pests. Although generally regarded as safe, B. thuringiensis is phylogenetically intermingled with the foodborne pathogen B. cereus sensu stricto and has been linked to foodborne outbreaks. Limited data on the pathogenicity potential of B. thuringiensis and the occurrence of biopesticide residues in food compromise a robust consumer risk assessment. In this study, we analyzed whole-genome sequences of 33 B.

      • Pesticide residues
      • Chemical contaminants
  19. AzuR From the SmtB/ArsR Family of Transcriptional Repressors Regulates Metallothionein in Anabaena sp. Strain PCC 7120

    • Frontiers in Microbiology
    • Metallothioneins (MTs) are cysteine-rich, metal-sequestering cytosolic proteins that play a key role in maintaining metal homeostasis and detoxification. We had previously characterized NmtA, a MT from the heterocystous, nitrogen-fixing cyanobacterium Anabaena sp. strain PCC 7120 and demonstrated its role in providing protection against cadmium toxicity.

      • Heavy Metals
      • Bacterial pathogens
      • Chemical contaminants
  20. SGP-C: A Broad Host Range Temperate Bacteriophage; Against Salmonella gallinarum

    • Frontiers in Microbiology
    • Salmonella gallinarum is a poultry restricted-pathogen causing fowl-typhoid disease in adult birds with mortality rates up-to 80% and exhibit resistance against commonly used antibiotics. In this current study, a temperate broad host range bacteriophage SGP-C was isolated against S. gallinarum from poultry digesta. It showed infection ability in all the 15 tested field strains of S. gallinarum. The SGP-C phage produced circular, turbid plaques with alternate rings.

      • Bacterial pathogens
  21. Discovery of Benzopyrrolizidines as Promising Antigiardiasic Agents

    • Frontiers in Cellular and Infection Microbiology
    • Current treatments for giardiasis include drugs with undesirable side effects, which increase the levels of therapeutic desertion and promote drug resistance in the parasites. Herein, we describe the antigiardiasic evaluation on Giardia lamblia trophozoites of a structurally diverse collection of 74 molecules.

      • Giardia lamblia
      • Parasites
  22. The global regulators ArcA and CytR collaboratively modulate Vibrio cholerae motility

    • BMC Microbiology
    • Vibrio cholerae, a Gram-negative bacterium, is highly motile owing to the presence of a single polar flagellum. The global anaerobiosis response regulator, ArcA regulates the expression of virulence factors an...

      • Vibrio
      • Bacterial pathogens
  23. Genome-Wide and Exome-Capturing Sequencing of a Gamma-Ray-Induced Mutant Reveals Biased Variations in Common Wheat

    • Frontiers in Plant Science
    • Induced mutagenesis is a powerful approach for the creation of novel germplasm and the improvement of agronomic traits. The evaluation of mutagenic effects and functional variations in crops is needed for breeding mutant strains. To investigate the mutagenic effects of gamma-ray irradiation in wheat, this study characterized genomic variations of wheat early heading mutant (eh1) as compared to wild-type (WT) Zhongyuan 9 (ZY9).

  24. Rhizobium Inoculation Enhances the Resistance of Alfalfa and Microbial Characteristics in Copper-Contaminated Soil

    • Frontiers in Microbiology
    • Some studies have reported the importance of rhizobium in mitigating heavy metal toxicity, however, the regulatory mechanism of the alfalfa-rhizobium symbiosis to resist copper (Cu) stress in the plant-soil system through biochemical reactions is still unclear. This study assessed the effects of rhizobium (Sinorhizobium meliloti CCNWSX0020) inoculation on the growth of alfalfa and soil microbial characteristics under Cu-stress.

  25. Probiotic Properties of Bifidobacterium longum KABP042 and Pediococcus pentosaceus KABP041 Show Potential to Counteract Functional Gastrointestinal Disorders in an Observational Pilot Trial in Infants

    • Frontiers in Microbiology
    • Functional gastrointestinal disorders (FGIDs) are a common concern during the first year of life. Recognized as gut-brain axis disorders by Rome IV criteria, FGIDs etiology is linked to altered gut-brain interaction, intestinal physiology, and microbiota. In this regard, probiotics have emerged as a promising therapy for infant FGIDs.