Research Publications (Food Safety)

Pullorum disease is characterized by white diarrhea resulting from infection by S. Pullorum, but arthritis associated with S. Pullorum infection has become increasingly frequent recently, especially in Chinese native chicken flocks.

This research aimed to assess the biofilm formation ability of Campylobacter strains under temperature and oxygen stress conditions, similar to those found in the industrial environment, to explain the persistence of this pathogen on the poultry slaughter line. A collection of C. jejuni and C.

Gram-positive Clostridium perfringens type G, the causative agent of necrotic enteritis (NE), has gained more attention in the poultry industry due to governmental restrictions on the use of growth-promoting antibiotics in poultry feed.

The study of non-typhoid Salmonella in broiler integrations has been limited by the resolution of typing techniques. Although serotyping of Salmonella isolates is used as a traditional approach, it is not of enough resolution to clearly understand the dynamics of this pathogen within poultry companies.

Salmonella Infantis has been the etiological agent of numerous foodborne outbreaks of nontyphoidal Salmonella. Consequently, there is an emergent need to mitigate Salmonella Infantis among poultry.

Salmonella enterica serovar Pullorum (S. Pullorum) causes pullorum disease (PD), which is an acute systemic disease, in chickens, and leads to serious economic losses in many developing countries because of its high morbidity and

Aflatoxin B1 (AFB1) is one of the most toxic mycotoxins. It has been reported that dietary exposure to AFB1 is related to the low growth performance, immunosuppression, and high susceptibility to infectious diseases of chickens. The aim of the present study was to evaluate the protective effects of Lactobacillus salivarius on broiler chickens challenged with AFB1.

Avian hepatitis E virus (HEV) is the major causative pathogen of the big liver and spleen disease, hepatitis-splenomegaly syndrome, and hepatic rupture hemorrhage syndrome. Until now, there are 6 different avian HEV genotypes that infect chickens have been reported worldwide.

MHCY is a candidate region for influencing immune responses in chickens. MHCY contains multiple specialized, polymorphic MHC class I loci along with loci belonging to 4 additional gene families.

Bacillus coagulans (B. coagulans) have proven to be effective in improving the development of gut immunity and microbiome, and offering protection against pathogens, especially in young animals. The newborn chicks are highly vulnerable to the foodborne pathogenic Salmonella infections, leading to high mortality and economic loss. However, whether B.

Salmonella Heidelberg (SH) is a highly invasive human pathogen for which turkeys can serve as reservoir hosts. Colonization of turkeys with SH may result in potential contamination and is a greater challenge to prevent in comminuted products.

Previous work has shown that cacao nib cadmium (Cd) concentrations decrease during fermentation, but only when reaching sufficiently low nib pH. In this work, lab-scale experiments (5 kg units) with lactic and acetic acid amendments were ineffective at reducing the total nib Cd concentration. In contrast, the water-extractable fraction of the nib Cd concentration clearly increased when the pH was decreased.

Foodborne pathogens tend to live in mixed-species biofilms with resident flora in the food industry, likely posing a higher risk of pathogen contamination due to the strong biofilm formation and disinfectant resistance.

The use of biological agents able to metabolize mycotoxins to non-toxic compounds is a strategy that has received growing interest. However, the high costs of laborious methods for identifying potential candidates are obstacles for new products development.

Ochratoxin A (OTA) is a major mycotoxin contaminant of cereals and grapes. Our previous study proved the ability of Cryptococcus podzolicus Y3 to degrade OTA. The main aim of the present study was to investigate the OTA degradation mechanism by C. podzolicus Y3 using Next-generation sequencing. The results that showed 427 and 100 genes were up- and down-regulated after OTA exposure, respectively.

Insecticidal activities of spinosad and chitin synthesis inhibitors (CSIs) have been individually assessed against some stored product insects, but the efficacy of their combinations against stored product insects was not previously reported.

The khapra beetle, Trogoderma granarium is a serious pest of stored grains in many nations. Larvae of T. granarium may be persistent in warehouse conditions due to the ability to enter facultative diapause.

Models were developed to quantify the risk of deoxynivalenol (DON) contamination of maize grain based on weather, cultural practices, hybrid resistance, and Gibberella ear rot (GER) intensity. Data on natural DON contamination of 15 to 16 hybrids and weather were collected from 10 Ohio locations over 4 years. Logistic regression with 10-fold cross-validation was used to develop models to predict the risk of DON ≥1 ppm.

Fungicides are the primary tools to control a wide range of postharvest fungal pathogens. Fungicide resistance is a widespread problem that has reduced the efficacy of fungicides. Resistance to FRAC-1 (Fungicide Resistance Action Committee-1) chemistries is associated with mutations in amino acid position 198 in the β-tubulin gene.

The aim was to investigate the effect of lotus seed resistant starch (LRS) on lactic acid (LA) conversion to butyric acid (BA) fermented by rat fecal microbiota to construct an acetyl CoA pathway. According to growth curves, the microbiota compositions at 10 and 36 h were further analyzed. The microbiota in the LRS group had higher richness and diversity compared to glucose (GLU) and high amylose maize starch (HAMS).

As antibodies are the main biological binder for hazards in food samples, their performance directly determines the sensitivity, specificity, and reproducibility of the developed immunoassay. The overwhelmingly used mammalian-derived antibodies usually suffer from complicated preparation, high cost, frequent bleeding of animals, and sometimes low titer and affinity.

Plantaricin EmF separated and identified from L. plantarum 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Its mode of action on L.